Recombinant Human ALS2CR2 protein (ab163093)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVF FKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
    • Amino acids
      319 to 418
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALS2 chromosome region gene 2
    • ALS2CR2
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 2
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein
    • CALS 21
    • CALS-21
    • ILP interacting protein ILPIPA
    • ILP-interacting protein
    • ILPIP
    • ILPIPA
    • Likely ortholog of mouse polyploidy associated protein kinase
    • PAPK
    • PRO1038
    • Pseudokinase ALS2CR2
    • STE20-related kinase adapter protein beta
    • STRAB_HUMAN
    • STRAD beta
    • STRADB
    see all
  • Function
    Pseudokinase which, in complex with CAB39, binds to and activates STK11. Relocates STK11 from the nucleus to the cytoplasm. Plays an essential role in STK11-mediated G1 cell cycle arrest.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle, testis, liver and colon.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab163093 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up