Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSFHPRGLQAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAAS SYLNLEKLGEGSYATVYKGISRINGQLVALKVISMNAEEGVPFTAIREAS LLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNV RLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKLADFGLARAKSI PSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLFP GVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVW NRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDE
    • Amino acids
      1 to 349
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as AL2S7. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2S7
    • AL2S7
    • ALS2CR7
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene protein 7
    • CDK15
    • CDK15_HUMAN
    • Cell division protein kinase 15
    • Cyclin-dependent kinase 15
    • EC 2.7.11.22
    • PFTAIRE protein kinase 2
    • PFTAIRE2
    • PFTK2
    • Serine/threonine protein kinase ALS2CR7
    • Serine/threonine protein kinase PFTAIRE 2
    • Serine/threonine-protein kinase ALS2CR7
    • Serine/threonine-protein kinase PFTAIRE-2
    see all
  • Function
    Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab163918 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up