Description

  • Product name

    Recombinant Human Aly/Ref protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFER KADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQ
    • Amino acids

      106 to 193
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Aly

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ally of AML-1 and LEF-1
    • Ally of AML1 and LEF1
    • ALY
    • ALY/REF
    • Aly/REF export factor
    • BEF
    • bZIP enhancing factor
    • bZIP-enhancing factor BEF
    • REF
    • THO complex 4
    • THO complex subunit 4
    • Tho4
    • thoc4
    • THOC4_HUMAN
    • Transcriptional coactivator
    • Transcriptional coactivator Aly/REF
    see all
  • Function

    Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between THOC4 and the THO complex. TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and THOC4. THOC4 in conjunction with THOC5 functions in NXF1-NXT1 mediated nuclear export of HSP70 mRNA.
    Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Acts as chaperone and promotes the dimerization of transcription factors containing basic leucine zipper (bZIP) domains and thereby promotes transcriptional activation. Plays a role in mRNA processing and export. May function as scaffold that mediates interactions between proteins and/or RNA. Is part of the exon junction complex that remains associated with spliced mRNA and plays an important role in mRNA export and nonsense-mediated RNA decay. Directs mRNA derived from Herpes simplex virus intron-less genes to the NXF1-mediated export pathway.
  • Sequence similarities

    Belongs to the THOC4 family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Arg-50 and Arg-204 are dimethylated, probably to asymmetric dimethylarginine.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Nucleus speckle. Cytoplasm. Colocalizes with the core EJC, THOC4, NXF1 and DDX39B in the nucleus and nuclear speckles. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA.
  • Information by UniProt

Images

  • ab153055 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up