Overview

  • Product name

    Recombinant human AMF protein (Bioactivity Validated)
    See all AMF proteins and peptides
  • Protein length

    Full length protein
  • Description

    Recombinant human AMF protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAALTRDPQFQKLQQWYREHRSELNLRRLF DANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMK SFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAI GLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINC FGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVW GEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFL AQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELD GSAQVTSHDASTNGLINFIKQQREARVQ
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 558
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000166

Specifications

Our Abpromise guarantee covers the use of ab208311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 400 units/mg obtained by measuring the increase of NADPH in absorbance at 340 nm resulting from the reduction of NADP. One unit will convert 1.0 umole of D-Fructose 6-phosphate to D-glucose 6-phosphate per minute at pH 7.4 at 37C.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab208311 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Glucose 6 phosphate isomerase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AMF
    • Aurocrine motility factor
    • Autocrine motility factor
    • DKFZp686C13233
    • EC 5.3.1.9
    • G6PI_HUMAN
    • Glucose phosphate isomerase
    • Glucose-6-phosphate isomerase
    • GNPI
    • GPI
    • Gpi1
    • Hexose monophosphate isomerase
    • Hexosephosphate isomerase
    • Neuroleukin
    • NLK
    • Oxoisomerase
    • PGI
    • PHI
    • Phosphoglucose isomerase
    • Phosphohexomutase
    • Phosphohexose isomerase
    • Phosphosaccharomutase
    • SA 36
    • SA-36
    • SA36
    • Sperm antigen 36
    see all
  • Function

    Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 2/4.
  • Involvement in disease

    Defects in GPI are the cause of hemolytic anemia non-spherocytic due to glucose phosphate isomerase deficiency (HA-GPID) [MIM:613470]. It is a form of anemia in which there is no abnormal hemoglobin or spherocytosis. It is caused by glucose phosphate isomerase deficiency. Severe GPI deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.
  • Sequence similarities

    Belongs to the GPI family.
  • Post-translational
    modifications

    Phosphorylation at Ser-185 by CK2 has been shown to decrease enzymatic activity and may contribute to secretion by a non-classical secretory pathway.
    ISGylated.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab208311.

References

ab208311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up