Recombinant Human Aminoadipate aminotransferase protein (ab162438)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAV KMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
    • Amino acids
      326 to 425
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 aminoadipate aminotransferase
    • 2 aminoadipate transaminase
    • 2-aminoadipate aminotransferase
    • 2-aminoadipate transaminase
    • Aadat
    • AADAT_HUMAN
    • Aadt
    • AI875679
    • Alpha aminoadipate aminotransferase
    • Alpha-aminoadipate aminotransferase
    • Aminoadipate aminotransferase
    • EC 2.6.1.39
    • EC 2.6.1.7
    • KAT/AadAT
    • KAT2
    • KATII
    • Kynurenine oxoglutarate transaminase 2
    • Kynurenine aminotransferase II
    • Kynurenine oxoglutarate aminotransferase II
    • Kynurenine oxoglutarate transaminase II
    • Kynurenine--oxoglutarate aminotransferase II
    • Kynurenine--oxoglutarate transaminase II
    • Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor]
    • Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    • L kynurenine/alpha aminoadipate aminotransferase
    see all
  • Function
    Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
  • Tissue specificity
    Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
  • Pathway
    Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 4/6.
  • Sequence similarities
    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162438 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up