Overview

  • Product name

    Recombinant Human AMN protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSVSKLWVPNTDFDVAANWSQNRTPCAGG AVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDC GAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPP SASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPG ALSVGPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACHSALRPQ GQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPR SSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATM RESGAHVWGSS
    • Molecular weight

      38 kDa including tags
    • Amino acids

      20 to 357
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139248 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 5033428N14Rik
    • amn
    • Amnion associated transmembrane protein
    • Amnionless
    • Amnionless homolog
    • AMNLS_HUMAN
    • AV002116
    • PRO1028
    • Protein amnionless
    • Type I transmembrane protein
    • UNQ513/PRO1028
    • Visceral endoderm specific type 1 transmembrane protein
    see all
  • Function

    Necessary for efficient absorption of vitamin B12. May direct the production of trunk mesoderm during development by modulating a bone morphogenetic protein (BMP) signaling pathway in the underlying visceral endoderm.
  • Tissue specificity

    Long isoforms are highly expressed in small intestine, colon and kidney (renal proximal tubule epithelial cells). Shorter isoforms are detected at lower levels in testis, thymus and peripheral blood leukocytes.
  • Involvement in disease

    Defects in AMN are a cause of recessive hereditary megaloblastic anemia 1 (RH-MGA1) [MIM:261100]; also known as MGA1 Norwegian type or Imerslund-Grasbeck syndrome (I-GS). RH-MGA1 is due to selective malabsorption of vitamin B12. Defects in vitamin B12 absorption lead to impaired function of thymidine synthase. As a consequence DNA synthesis is interrupted. Rapidly dividing cells involved in erythropoiesis are particularly affected.
  • Sequence similarities

    Contains 1 VWFC domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139248.

References

ab139248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up