Description

  • Product name

    Recombinant Human AMOTL2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLT RASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQ AGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALG NAQGRAARAEEELRKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTR LEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQILALE ADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNE GLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLR PAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTA PPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSV ATSRVQDLSDMVEILI
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      314 to 779

Specifications

Our Abpromise guarantee covers the use of ab132654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AMOL2_HUMAN
    • Amotl2
    • angiomotin like 2
    • Angiomotin-like protein 2
    • KIAA0989
    • LCCP
    • Leman coiled coil protein
    • Leman coiled-coil protein
    see all
  • Sequence similarities

    Belongs to the angiomotin family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132654 stained with Coomassie Blue.

References

ab132654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up