Description

  • Product name

    Recombinant Human AMPD2 protein
  • Purity

    > 85 % SDS-PAGE.
    ab187468 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSDLLDAAKSVVRALFIREKYMALSLQSF CPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPPALEQHPYEHCEP STMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVNVL MALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNI RKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFES MNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNR VSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHR VHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHP ELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYY TFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLL LRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLS TDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVK SHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEM LETIPEEAGITMSPGPQ
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      236 to 879
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_004028

Specifications

Our Abpromise guarantee covers the use of ab187468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Adenosine monophosphate deaminase 2
    • Adenosine monophosphate deaminase 2 (isoform L)
    • adenosine monophosphate deaminase 2 isoform L
    • AMP deaminase 2
    • AMP deaminase isoform L
    • AMPD
    • AMPD 2
    • AMPD2
    • AMPD2_HUMAN
    • RP5-1160K1.5
    • SPG63
    see all
  • Function

    AMP deaminase plays a critical role in energy metabolism.
  • Tissue specificity

    Three isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes.
  • Pathway

    Purine metabolism; IMP biosynthesis via salvage pathway; IMP from AMP: step 1/1.
  • Sequence similarities

    Belongs to the adenosine and AMP deaminases family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187468 (3μg).

References

ab187468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up