Bioactive grade

Recombinant human Amphiregulin protein (Active) (ab229600)

Description

  • Product name

    Recombinant human Amphiregulin protein (Active)
    See all Amphiregulin proteins and peptides
  • Biological activity

    3T3 Cell Proliferation.

    ED50 ≤ 20 ng/ml (≥ 5.0 x 104 units/mg).

  • Purity

    >= 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK
    • Predicted molecular weight

      10 kDa
    • Amino acids

      101 to 187
    • Additional sequence information

      This product is the mature full length protein from aa 101 to 187. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab229600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • A REG
    • Amphiregulin
    • Amphiregulin B
    • AR
    • AREG
    • AREG_HUMAN
    • AREGB
    • Colorectum cell derived growth factor
    • Colorectum cell-derived growth factor
    • CRDGF
    • MGC13647
    • Schwannoma derived growth factor
    • SDGF
    see all
  • Function

    Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells.
  • Sequence similarities

    Belongs to the amphiregulin family.
    Contains 1 EGF-like domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab229600 induced proliferation of 3T3 cells.

  • 1 µg ab229600 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab229600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up