Description

  • Product name

    Recombinant Human AMPK alpha 1 protein
    See all AMPK alpha 1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202156 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMRRLSSWRKMATAEKQKHDGRVKIGHY ILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQ NLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKES RRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSD GEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDD DHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHE WF
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 279
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006242.

Specifications

Our Abpromise guarantee covers the use of ab202156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 5 AMP activated protein kinase alpha 1catalytic subunit
    • 5 AMP activated protein kinase catalytic alpha 1 chain
    • 5' AMP activated protein kinase catalytic subunit alpha 1
    • 5'-AMP-activated protein kinase catalytic subunit alpha-1
    • AAPK1
    • AAPK1_HUMAN
    • ACACA kinase
    • acetyl CoA carboxylase kinase
    • AI194361
    • AI450832
    • AL024255
    • AMP -activate kinase alpha 1 subunit
    • AMP-activate kinase alpha 1 subunit
    • AMP-activated protein kinase, catalytic, alpha -1
    • AMPK
    • AMPK 1
    • AMPK alpha 1
    • AMPK alpha 1 chain
    • AMPK subunit alpha 1
    • AMPK subunit alpha-1
    • AMPK1
    • AMPKa1
    • AMPKalpha1
    • C130083N04Rik
    • cb116
    • EC 2.7.11.1
    • HMG CoA reductase kinase
    • HMGCR kinase
    • hormone sensitive lipase kinase
    • Hydroxymethylglutaryl CoA reductase kinase
    • im:7154392
    • kinase AMPK alpha1
    • MGC33776
    • MGC57364
    • OTTHUMP00000161795
    • OTTHUMP00000161796
    • PRKAA 1
    • PRKAA1
    • Protein kinase AMP activated alpha 1 catalytic subunit
    • SNF1-like protein AMPK
    • SNF1A
    • Tau protein kinase PRKAA1
    • wu:fa94c10
    see all
  • Function

    Responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. It also regulates cholesterol synthesis via phosphorylation and inactivation of hormone-sensitive lipase and hydroxymethylglutaryl-CoA reductase. Appears to act as a metabolic stress-sensing protein kinase switching off biosynthetic pathways when cellular ATP levels are depleted and when 5'-AMP rises in response to fuel limitation and/or hypoxia. This is a catalytic subunit.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202156 (3µg).

References

ab202156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up