Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSE EIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW SKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVN NIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERF RAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMV LSATHRYKKKYVTTLLYKPI
    • Molecular weight
      69 kDa including tags
    • Amino acids
      1 to 270
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NM_006253

Specifications

Our Abpromise guarantee covers the use of ab177266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 90 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.82% Sodium phosphate, 1.75% Sodium chloride, 0.002% PMSF, 0.004% DTT, 25% Glycerol

General Info

  • Alternative names
    • 1300015D22Rik
    • 5''-AMP-activated protein kinase subunit beta-1
    • 5'-AMP-activated protein kinase beta-1 subunit
    • AAKB1_HUMAN
    • AMP-activated protein kinase beta subunit
    • AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1
    • AMP-activated, noncatalytic, beta-1
    • AMPK
    • AMPK beta 1 chain
    • AMPK subunit beta-1
    • AMPK-BETA-1
    • AMPKb
    • AU021155
    • E430008F22
    • HAMPKb
    • MGC17785
    • PRKAB1
    • Protein kinase AMP activated non catalytic subunit beta 1
    • protein kinase, AMP-activated, beta 1 non-catalytic subunit
    • protein kinase, AMP-activated, noncatalytic, beta-1
    see all
  • Function
    Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
  • Sequence similarities
    Belongs to the 5'-AMP-activated protein kinase beta subunit family.
  • Domain
    The glycogen-binding domain may target AMPK to glycogen so that other factors like glycogen-bound debranching enzyme or protein phosphatases can directly affect AMPK activity.
  • Post-translational
    modifications
    Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK.
  • Information by UniProt

Images

  • Sample Kinase activity plot.

     

  • SDS-PAGE analysis of ab177266.

References

ab177266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up