Overview

  • Product name

    Recombinant Human AMY-1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKH HLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEK RAE
    • Amino acids

      1 to 103
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as MYCBP.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AMY 1
    • AMY-1
    • AMY1
    • Associate of Myc 1
    • C myc binding protein
    • C-Myc-binding protein
    • Cmyc binding protein
    • MYCBP
    • MYCBP_HUMAN
    see all
  • Function

    May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
  • Tissue specificity

    Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
  • Sequence similarities

    Belongs to the AMY1 family.
  • Cellular localization

    Cytoplasm. Nucleus. Mitochondrion. Translocates into the nucleus in the S phase of the cell cycle upon an increase of MYC expression. Found in the mitochondria when associated with AKAP1.
  • Information by UniProt

Images

  • ab161965 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up