Overview

  • Product name

    Recombinant Human AMY2B protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVA IHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVIN HMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIEN YNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASK HMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGN GRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHD NQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQN GNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNV VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYC DVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHH HHHH
    • Molecular weight

      57 kDa including tags
    • Amino acids

      16 to 511
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 16 to 511. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab199584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µm filtered solution.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names

    • 1
    • 1,4-alpha-D-glucan glucanohydrolase
    • 1,4-alpha-D-glucan glucanohydrolase 2B
    • 4-alpha-D-glucan glucanohydrolase 2B
    • Alpha-amylase 2B
    • Alpha-amylase carcinoid
    • AMY2
    • AMY2B
    • AMY2B_HUMAN
    • Amylase, alpha 2B (pancreatic)
    • amylase, alpha 2B; pancreatic
    • Amylase, pancreatic, alpha-2B
    • Carcinoid alpha-amylase
    • EC 3.2.1.1
    • Glycogenase
    • OTTHUMP00000012696
    see all
  • Sequence similarities

    Belongs to the glycosyl hydrolase 13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab199584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up