Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV HSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 89

Specifications

Our Abpromise guarantee covers the use of ab132690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Amylin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amylin
    • DAP
    • Diabetes associated peptide
    • Diabetes-associated peptide
    • IAP
    • IAPP
    • IAPP_HUMAN
    • Insulinoma amyloid peptide
    • Islet amyloid polypeptide
    • Islet amyloid polypeptide (diabetes associated peptide; amylin)
    see all
  • Function

    Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Sequence similarities

    Belongs to the calcitonin family.
  • Domain

    The mature protein is largely unstructured in the absence of a cognate ligand, and has a strong tendency to form fibrillar aggregates. Homodimerization may be the first step of amyloid formation.
  • Post-translational
    modifications

    Amyloid fibrils are degraded by IDE.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132690 stained with Coomassie Blue.

References

ab132690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up