Description

  • Product name

    Recombinant Human Angiopoietin 2/ANG2 protein (His tag)
    See all Angiopoietin 2/ANG2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTI IQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIH LKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFS TKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKW YYWKGSGYSLKATTMMIRPADF
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      275 to 496
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAI26201.1.

Specifications

Our Abpromise guarantee covers the use of ab220589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Angiopoietin 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AGPT 2
    • Agpt2
    • ANG 2
    • ANG-2
    • ANG2
    • Angiopoietin 2a
    • Angiopoietin 2B
    • Angiopoietin-2
    • Angiopoietin2
    • ANGP2_HUMAN
    • ANGPT 2
    • Angpt2
    • Tie2 ligand
    see all
  • Function

    Can induce tyrosine phosphorylation of TIE2. Binds to TIE2 receptor and counteracts blood vessel maturation/stability mediated by angiopoietin-1. Its function may be context-dependent. In the absence of angiogenic inducers, such as VEGF, ANG2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    The Fibrinogen C-terminal domain mediates interaction with the TEK/TIE2 receptor.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220589 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 30-33 kDa in SDS-PAGE due to glycosylation.

References

ab220589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up