Description

  • Product name

    Recombinant Human Angiotensin II Type 1 Receptor protein
    See all Angiotensin II Type 1 Receptor proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNP LFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSST KKPAPCFEVE
    • Amino acids

      250 to 359
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AG2S
    • Agtr 1
    • Agtr1
    • AGTR1_HUMAN
    • Agtr1a
    • AGTR1B
    • Ang II
    • Angiotensin II receptor type 1
    • Angiotensin II type-1 receptor
    • Angiotensin receptor 1
    • Angiotensin receptor 1B
    • AT 1B
    • AT 1r
    • AT1
    • At1a
    • AT1AR
    • AT1B
    • AT1BR
    • AT1R
    • AT2R1
    • AT2R1A
    • AT2R1B
    • HAT1R
    • Type 1 angiotensin II receptor
    • Type 1B angiotensin II receptor
    • Type-1 angiotensin II receptor
    see all
  • Function

    Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity

    Liver, lung, adrenal and adrenocortical adenomas.
  • Involvement in disease

    Defects in AGTR1 are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    C-terminal Ser or Thr residues may be phosphorylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab157870 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up