Recombinant Human Angiotensinogen protein (BSA and azide free) (ab178470)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% Densitometry
- Endotoxin level: < 1.000 Eu/µg
- Tags: DDDDK tag C-Terminus
- Suitable for: MS, ELISA, WB, SDS-PAGE
Description
-
Product name
Recombinant Human Angiotensinogen protein (BSA and azide free)
See all Angiotensinogen proteins and peptides -
Purity
> 95 % Densitometry.
ab178470 is filtered (0.4 µm). -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKA LQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATV LSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSA LQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPV VLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLTGASVDSTLAFNTYVH FQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQ VSFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQ LVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLS TARTDYKDDDDK -
Predicted molecular weight
51 kDa including tags -
Amino acids
34 to 485 -
Tags
DDDDK tag C-Terminus -
Additional sequence information
C-terminal linker (2 extra amino acids)
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab178470 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
ELISA
Western blot
SDS-PAGE
-
Mass spectrometry
LC-MS/MS -
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
Constituents: 0.29% Sodium chloride, 0.24% Tris
-
ReconstitutionAdd 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely.
General Info
-
Alternative names
- Aangiotensinogen (serpin peptidase inhibitor clade A member 8)
- AGT
- AI265500
see all -
Function
Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2.
Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
Angiotensin-3 stimulates aldosterone release.
Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets. -
Tissue specificity
Expressed by the liver and secreted in plasma. -
Involvement in disease
Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT) [MIM:145500]. Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause.
Defects in AGT are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). -
Sequence similarities
Belongs to the serpin family. -
Post-translational
modificationsBeta-decarboxylation of Asp-34 in angiotensin-2, by mononuclear leukocytes produces alanine. The resulting peptide form, angiotensin-A, has the same affinity for the AT1 receptor as angiotensin-2, but a higher affinity for the AT2 receptor. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab178470 has not yet been referenced specifically in any publications.