For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-angiotensinogen-protein-bsa-and-azide-free-ab178470.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Fibrinolysis / Thrombolysis
Share by email

Recombinant Human Angiotensinogen protein (BSA and azide free) (ab178470)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Angiotensinogen protein (BSA and azide free) (ab178470)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 95% Densitometry
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: DDDDK tag C-Terminus
    • Suitable for: MS, ELISA, WB, SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human AGT ELISA kit (ab267592)

    View more associated products

    Description

    • Product name

      Recombinant Human Angiotensinogen protein (BSA and azide free)
      See all Angiotensinogen proteins and peptides
    • Purity

      > 95 % Densitometry.
      ab178470 is filtered (0.4 µm).
    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P01019
    • Protein length

      Full length protein
    • Animal free

      No
    • Carrier free

      Yes
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKA LQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATV LSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSA LQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPV VLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLTGASVDSTLAFNTYVH FQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQ VSFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQ LVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLS TARTDYKDDDDK
      • Predicted molecular weight

        51 kDa including tags
      • Amino acids

        34 to 485
      • Tags

        DDDDK tag C-Terminus
      • Additional sequence information

        C-terminal linker (2 extra amino acids)

    Associated products

    • Related Products

      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
      • PE Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [M2] (ab72469)

    Specifications

    Our Abpromise guarantee covers the use of ab178470 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Mass Spectrometry

      ELISA

      Western blot

      SDS-PAGE

    • Mass spectrometry

      LC-MS/MS
    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

      Constituents: 0.29% Sodium chloride, 0.24% Tris

    • Reconstitution
      Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely.

    General Info

    • Alternative names

      • Aangiotensinogen (serpin peptidase inhibitor clade A member 8)
      • AGT
      • AI265500
      • Alpha 1 antiproteinase antitrypsin
      • Ang
      • Ang I
      • Ang II
      • Ang III
      • AngII
      • Angiotensin I
      • Angiotensin II
      • Angiotensin III
      • Angiotensin-3
      • Angiotensinogen
      • Angiotensinogen (PAT)
      • ANGT_HUMAN
      • ANHU
      • ANRT
      • AT-2
      • AT-II
      • Des-Asp[1]-angiotensin II
      • FLJ92595
      • FLJ97926
      • MGC105326
      • PAT
      • Pre angiotensinogen
      • Serine (or cysteine) proteinase inhibitor
      • Serpin A8
      • Serpin peptidase inhibitor clade A member 8
      • SERPINA8
      see all
    • Function

      Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2.
      Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
      Angiotensin-3 stimulates aldosterone release.
      Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
    • Tissue specificity

      Expressed by the liver and secreted in plasma.
    • Involvement in disease

      Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT) [MIM:145500]. Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause.
      Defects in AGT are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
    • Sequence similarities

      Belongs to the serpin family.
    • Post-translational
      modifications

      Beta-decarboxylation of Asp-34 in angiotensin-2, by mononuclear leukocytes produces alanine. The resulting peptide form, angiotensin-A, has the same affinity for the AT1 receptor as angiotensin-2, but a higher affinity for the AT2 receptor.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P01019 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Angiotensinogen protein (BSA and azide free) (ab178470)
      SDS-PAGE - Recombinant Human Angiotensinogen protein (BSA and azide free) (ab178470)

      SDS-PAGE analysis of ab178470

      1) Reduced and heated sample, 2.5 μg/lane

      2) Non-reduced and non-heated sample, 2.5 μg/lane.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab178470? Please let us know so that we can cite the reference in this datasheet.

    ab178470 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab178470.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.