Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKG QINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNM SLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKT FVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISL SSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSN SQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLG LEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAIT GNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGK YNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHH HH
    • Molecular weight

      53 kDa including tags
    • Amino acids

      17 to 460
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form. NP_055310.1.

Specifications

Our Abpromise guarantee covers the use of ab176028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by binding ability to recombinant αvβ3 integrin in a functional ELISA

  • Applications

    Functional Studies

    ELISA

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • ANG 5
    • ANG-5
    • ANG5
    • Angiopoietin 5
    • Angiopoietin like 3
    • Angiopoietin related protein 3
    • Angiopoietin-5
    • Angiopoietin-like protein 3
    • Angiopoietin-related protein 3
    • ANGL3_HUMAN
    • ANGPT5
    • ANGPTL3
    • ANL3
    • FHBL2
    • OTTHUMP00000010719
    • UNQ153/PRO179
    see all
  • Tissue specificity

    Expressed principally in liver. Weakly expressed in kidney.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

This product has been referenced in:

  • Bao Y  et al. Angiopoietin-like protein 3 blocks nuclear import of FAK and contributes to sorafenib response. Br J Cancer 119:450-461 (2018). Read more (PubMed: 30033448) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up