Description

  • Product name

    Recombinant Human ANGPTL3 protein (His tag)
    See all ANGPTL3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKG QINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNM SLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKT FVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIE
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      17 to 220
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_055310.

Specifications

Our Abpromise guarantee covers the use of ab220452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • ANG 5
    • ANG-5
    • ANG5
    • Angiopoietin 5
    • Angiopoietin like 3
    • Angiopoietin related protein 3
    • Angiopoietin-5
    • Angiopoietin-like protein 3
    • Angiopoietin-related protein 3
    • ANGL3_HUMAN
    • ANGPT5
    • ANGPTL3
    • ANL3
    • FHBL2
    • OTTHUMP00000010719
    • UNQ153/PRO179
    see all
  • Tissue specificity

    Expressed principally in liver. Weakly expressed in kidney.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220452 stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 26-38 kDa.

References

ab220452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up