Overview

  • Product name

    Recombinant Human Anillin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGK RTLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVC STVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALTFTTTFTLQ DVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSN IHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLE GHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTY PDDEKRKNPIGRINLANCTSRQIEPANREFRARRNTFELITVRPQREDDR ETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYK PIGKL
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 405

Specifications

Our Abpromise guarantee covers the use of ab132001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin binding protein scraps homolog Drosophila
    • Actin binding protein anillin
    • Actin-binding protein anillin
    • Anillin actin binding protein
    • anln
    • ANLN_HUMAN
    • DKFZp779A055
    • FSGS8
    • Scra
    • Scraps
    • Scraps homolog
    see all
  • Function

    Required for cytokinesis. Essential for the structural integrity of the cleavage furrow and for completion of cleavage furrow ingression.
  • Tissue specificity

    Ubiquitously expressed. Present at highest levels in the brain, at high levels in the placenta and testis, at intermediate levels in the intestine, ovary, skeletal muscle and thymus and at lower levels in heart, kidney, liver, lung, pancreas, prostate and spleen. Overexpressed in many tumor types including breast, colorectal, endometrial, hepatic, kidney, lung, ovarian and pancreatic tumors.
  • Sequence similarities

    Contains 1 PH domain.
  • Developmental stage

    Expressed in fetal brain, heart, kidney, liver, lung, skeletal muscle, spleen and thymus. In dividing cells expression increases during S and G2 phases, peaks at mitosis and subsequently drops as cells enter G1 phase.
  • Post-translational
    modifications

    Phosphorylated during mitosis.
    Ubiquitinated, and this requires FZR1/CDH1.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Mainly found in the nucleus during interphase. Colocalizes with cortical F-actin upon nuclear envelope breakdown in mitosis and subsequently concentrates in the area of the prospective contractile ring in anaphase. This pattern persists until telophase, when the protein becomes concentrated in the midbody.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132001 stained with Coomassie Blue.

References

ab132001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up