Overview

  • Product name

    Recombinant human ANKK1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAI KCAPCLPPDAASSDVNYLIEEAAKMKKIKFQHIVSIYGVCKQPLGIVMEF MANGSLEKVLSTHSLCWKLRFRIIHETSLAMNFLHSIKPPLLHLDLKPGN ILLDSNMHVKISDFGLSKWMEQSTRMQYIERSALRGMLSYIPPEMFLESN KAPGPKYDVYSFAIVIWELLTQKKPYSGFNMMMIIIRVAA GMRPSLQP VSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLDITIETDILLSLLQSRVAV PESKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKN LVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTP LLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLL DHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPL HVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLK SGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLH LAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQC GADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHL AALKGNTAILKVLVEAGAQLDVQDGVSCTPLQLALRSRKQGIMSFLEGKE PSVATLGGSKPGAEMEI
    • Molecular weight

      115 kDa including tags
    • Amino acids

      1 to 765
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_178510.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The Specific activity of ab204164 was determined to be 80 nmol/min/mg.

  • Applications

    Western blot

    SDS-PAGE

    Functional Studies

  • Purity

    > 75 % Densitometry.

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Ankyrin repeat and kinase domain containing 1
    • Ankyrin repeat and protein kinase domain containing protein 1
    • EC 2.7.11.1
    • PKK2
    • Protein kinase PKK2
    • SGK288
    • Sugen kinase 288
    • X kinase
    see all
  • Relevance

    ANKK1 belongs to the TKL Ser/Thr protein kinase superfamily, contains twelve ANK repeats and one protein kinase domain. The protein is weakly expressed in testis, placenta, and spinal cord.

Images

  • Analysis of the purity of ab204164 by densitometry.

  • Kinase assay demonstrating specific activity of ab204164.

References

ab204164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up