Overview

  • Product name
    Recombinant Human ANKMY1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGAHASLSLEDEVSGAGSRQRPLEGKGGETPAAEEPGSLKNYAVFATRD VSAAPEKEEEEAEGPLRAQDLRESYIQLVQGVQEWQDGCMYQGEFGLNMK LGYGKFSWPTGESYHGQFYRDHCHGLGTYMWPDGSSFTGTFYLSHREGYG TMYMKTRLFQTHCHNDIVNLLLDCGADVNKCSDEGLTALSMCFLLHYPAQ SFKPNVAERTIPEPQEPPKFPVVPILSSSFMDTNLESLYYEVNVPSQGSY ELRPPPAPLLLPRVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLVKGS LGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQ SHSLLKMASPSPCTSSFDKGTMRRMALSMIERRKRWRTIKLLLRRGADPN LCCVPMQVLFLAVKAGDVDGVRLLLEHGARTDICFPPQLSTLTPLHIAAA LPGEEGVQIVELLLHAITDVDAKASDEDDTYKPGKLDLLPSSLKLSNEPG PPQAYYSTDTALPEEGGRTALHMACEREDDNKIDRLISHGADILKPVMLR QGEKEAVGTAVDYGYFRFFQDRRIARCPFHTLMPAERETFLARKRLLEYM GLQLRQAVFAKESQWDPTWLYLCKRAELIPSHRMKKKGPSLPRGLDVKEQ GQIPFFKFCYQCGRSIGVRLLPCPRCYGILTCSKYCKTKAWTEFHKKDCG DLVAIVTQLEQVSRRREEFQ
    • Amino acids
      1 to 720
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ankyrin repeat and MYND domain containing 1
    • DKFZp686D20155
    • DKFZp686L21237
    • FLJ20499
    • Testis specific ankyrin like protein 1
    • TSAL1
    • Zinc finger MYND domain containing protein 13
    • ZMYND13
    see all
  • Relevance
    ANKMY1 contains 7 ANK repeats, 3 MORN repeats and 1 MYND-type zinc finger. There are three isoforms.

Images

  • ab162490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up