Description

  • Product name

    Recombinant Human ANKRA2 protein
  • Purity

    > 85 % SDS-PAGE.
    ab183225 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMDTSTNLDIGAQLIVEECPSTYSLTGM PDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDS KNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIK QSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINH TDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGY TDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIE TDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 313
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_075526

Specifications

Our Abpromise guarantee covers the use of ab183225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • ANKRA
    • ANKRA 2
    • ANKRA2
    • Ankyrin repeat family A (RFXANK like) 2
    • Ankyrin repeat family A 2
    • Ankyrin repeat family A protein 2
    • Ankyrin repeat-containing protein, family A, member 2
    • ANRA2_HUMAN
    • C11
    • C11 - RNP3
    • hRPC11
    • My010
    • OTTHUMP00000128195
    • RFXANK like 2
    • RFXANK-like protein 2
    • RPC10
    • RPC11
    • RPC12.5
    see all
  • Function

    May facilitate endocytosis by linking megalin to components of the cytoskeleton or endocytic machinery.
  • Sequence similarities

    Contains 3 ANK repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton. Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183225 (3μg).

References

ab183225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up