Recombinant Human ANKRD16 protein (ab132916)

Overview

  • Product name

    Recombinant Human ANKRD16 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHR DVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCL KKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDP LILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDY RDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTG QDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADI NSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD VLQGSGHSAMT
    • Molecular weight

      66 kDa including tags
    • Amino acids

      1 to 361

Specifications

Our Abpromise guarantee covers the use of ab132916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ankrd16
    • Ankyrin repeat domain 16
    • Ankyrin repeat domain-containing protein 16
    • ANR16_HUMAN
    • DKFZP434N1511
    see all
  • Sequence similarities

    Contains 9 ANK repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132916, stained with Coomassie Blue.

References

ab132916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up