Overview

  • Product name
    Recombinant Human ANKRD37 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQ LQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTA EDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVE NTSGKRKC
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRD37
    • Ankyrin repeat domain 37
    • Ankyrin repeat domain containing protein 37
    • Ankyrin repeat domain-containing protein 37
    • ANR37_HUMAN
    • hLrp2bp
    • Low density lipoprotein receptor related protein 2 binding protein
    • Low density lipoprotein receptor related protein binding protein
    • Low-density lipoprotein receptor-related protein 2-binding protein
    • LPR2BP
    • MGC111507
    see all
  • Tissue specificity
    Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells.
  • Sequence similarities
    Contains 3 ANK repeats.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab166350 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up