Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGG AGLSGRASGGAQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRR LGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFA SCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGA RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLE RLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 300
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Ankrd54
    • ankyrin repeat domain 54
    • Ankyrin repeat domain-containing protein 54
    • ANR54_HUMAN
    • LIAR
    • OTTHUMP00000198182
    • OTTHUMP00000198183
    • OTTHUMP00000198184
    • OTTHUMP00000198186
    see all
  • Sequence similarities
    Contains 4 ANK repeats.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab156716 at 3ug.

References

ab156716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up