Overview

  • Product name

    Recombinant Human Ankyrin erythroid/ANK protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MWTFVTQLLVTLVLLSFFLVSCQNVMHIVRGSLCFVLKHIHQELDKELGE SEDLSDDEETISTRVVRRRVFLKGNEFQNIPGEQVTEEQFTDEQGNIVTK KIIRKVVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRKGAQIVKRASL KRGKQ
    • Amino acids

      1 to 155
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as Ankyrin erythroid.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ANK
    • ANK-1
    • Ank1
    • ANK1_HUMAN
    • Ankyrin 1
    • Ankyrin 1, erythrocytic
    • Ankyrin R
    • Ankyrin-1
    • Ankyrin-R
    • Erythrocyte ankyrin
    • SPH1
    • SPH2
    see all
  • Function

    Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions.
    Isoform Mu17 together with obscurin in skeletal muscle may provide a molecular link between the sarcoplasmic reticulum and myofibrils.
  • Tissue specificity

    Isoform Mu17, isoform Mu18, isoform Mu19 and isoform Mu20 are expressed in skeletal muscle. Isoform Br21 is expressed in brain.
  • Involvement in disease

    Defects in ANK1 are a cause of spherocytosis type 1 (SPH1) [MIM:182900]; also called hereditary spherocytosis type 1 (HS1). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Inheritance can be autosomal dominant or recessive.
  • Sequence similarities

    Contains 23 ANK repeats.
    Contains 1 death domain.
    Contains 1 ZU5 domain.
  • Domain

    The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3.
    The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters.
  • Post-translational
    modifications

    Regulated by phosphorylation.
    Palmitoylated.
  • Cellular localization

    Cytoplasm > cytoskeleton. Probably the other erythrocyte (Er) isoforms, are located near the surface of erythrocytic plasma membrane; Sarcoplasmic reticulum and Membrane. Cytoplasm > myofibril > sarcomere > M line. Colocalizes with OBSCN isoform 3/obscurin at the M line in differentiated skeletal muscle cells.
  • Information by UniProt

Images

  • ab157890 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up