Description

  • Product name

    Recombinant Human Annexin-13/ANXA13 protein
  • Purity

    > 90 % SDS-PAGE.
    ab105616 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGNRHAKASSPQGFDVDRDAKKLNKACKGM GTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTA LALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQR LFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSG DLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDL QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1 to 316
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as Annexin A13. 

     This product was previously labelled as ANXA13

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Annexin A13
    • Annexin XIII
    • Annexin, intestine-specific
    • Annexin-13
    • ANX 13
    • ANX A13
    • ANX13
    • ANX13_HUMAN
    • ANXA13
    • Intestine Specific Annexin
    • Intestine-specific annexin
    • ISA
    • MGC150460
    see all
  • Tissue specificity

    Gut specific.
  • Sequence similarities

    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain

    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Cellular localization

    Cell membrane. Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab105616.

References

ab105616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up