Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQR QEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHAL KGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQ RMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGT RSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAY LAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI KGDTSGDYKKALLLLCGEDD
    • Molecular weight
      36 kDa
    • Amino acids
      1 to 320
  • Conjugation
    Phycoerythrin. Ex: 488nm, Em: 575nm

Specifications

Our Abpromise guarantee covers the use of ab157016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Flow Cytometry

    SDS-PAGE

    HPLC

  • Purity
    70 - 90% by HPLC.
    ab157016 was determined to be >85% pure by SDS-PAGE and HPLC.
  • Form
    Liquid
  • Additional notes
    ab157016 can be used for detection of apoptotic cells by flow cytometry. It is suitable for dual staining experiments to detect phosphatidylserine whilst cell-surface protein can be detected with a suitable secondary antibody.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C. Do Not Freeze. Store In the Dark.

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 0.61% Tris, 0.58% Sodium chloride, 1% BSA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Anchorin CII
    • Annexin 5
    • Annexin A5
    • Annexin V
    • Annexin-5
    • ANX A5
    • ANX5
    • ANXA5
    • ANXA5_HUMAN
    • Calphobindin I
    • CBP-I
    • Endonexin II
    • ENX2
    • Lipocortin V
    • PAP I
    • PAP-I
    • Placental anticoagulant protein 4
    • Placental anticoagulant protein I
    • PLACENTAL PROTEIN 4
    • Pp4
    • Thromboplastin inhibitor
    • VAC-alpha
    • Vascular anticoagulant-alpha
    see all
  • Function
    This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Involvement in disease
    Pregnancy loss, recurrent, 3
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    The [IL]-x-C-x-x-[DE] motif is a proposed target motif for cysteine S-nitrosylation mediated by the iNOS-S100A8/A9 transnitrosylase complex.
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Post-translational
    modifications
    S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex.
  • Information by UniProt

References

ab157016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up