Recombinant Human ANO6 protein (ab153622)

Description

  • Product name

    Recombinant Human ANO6 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEF EEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYE SNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPND LKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRD AFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDC KFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQ CDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQ AELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCI RITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPKNINGTDPIQK YLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSL TMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWE QDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIR VDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMI PRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDL GNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLALIIVMEHVIYSVKF FISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA VDNNLRPKSE
    • Amino acids

      1 to 910
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2900059G15Rik
    • AA407480
    • Ano6
    • ANO6_HUMAN
    • Anoctamin 6
    • Anoctamin-6
    • AW554778
    • BDPLT7
    • F730003B03Rik
    • MGC104751
    • SCTS
    • TMEM16F
    • Transmembrane protein 16F
    see all
  • Function

    May act as a calcium-activated chloride channel. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system.
  • Tissue specificity

    Expressed in embryonic stem cell, fetal liver, retina, chronic myologenous leukemia and intestinal cancer.
  • Involvement in disease

    Defects in ANO6 are the cause of Scott syndrome (SCOTTS) [MIM:262890]. A mild bleeding disorder due to impaired surface exposure of procoagulant phosphatidylserine (PS) on platelets and other blood cells, following activation with Ca(2+)-elevating agents.
  • Sequence similarities

    Belongs to the anoctamin family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab153622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up