Overview

  • Product name

    Recombinant Human ANP32E protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMA NVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKI KDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQ EDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDE DEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGL RGEKRKRDAEDDGEEEDD
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 268

Specifications

Our Abpromise guarantee covers the use of ab132173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as LANPL

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acidic (leucine rich) nuclear phosphoprotein 32 family member E
    • Acidic leucine-rich nuclear phosphoprotein 32 family member E
    • AN32E_HUMAN
    • anp32e
    • Cerebellar postnatal development protein 1
    • LANP like protein
    • LANP-L
    • LANP-like protein
    • LANPL
    • Leucine rich acidic nuclear protein like
    • MGC5350
    see all
  • Function

    Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis process by modulating PP2A activity.
  • Tissue specificity

    Expressed in peripheral blood leukocytes, colon, small intestine, prostate, thymus, spleen, skeletal muscle, liver and kidney.
  • Sequence similarities

    Belongs to the ANP32 family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Post-translational
    modifications

    Phosphorylated. The phosphorylation is nuclear localization signal (NLS)-dependent.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132173 stained with Coomassie Blue.

References

ab132173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up