Overview

  • Product name
    Recombinant Human ANT4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQV QASSKQISPEARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALN FAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFAR TRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYR ASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILSYPFDTVRRRM MMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL YDKIKEFFHIDIGGR
    • Amino acids
      1 to 315
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLC25A31.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAC4
    • Adenine nucleotide translocator 4
    • ADP
    • ADP,ATP carrier protein 4
    • ADP/ATP translocase 4
    • ADT4_HUMAN
    • ANT 4
    • ANT4
    • ATP carrier protein 4
    • SFEC
    • Slc25a31
    • Solute carrier family 25 member 31
    • Sperm flagellar energy carrier protein
    see all
  • Function
    Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. May serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.
  • Tissue specificity
    Expressed in brain, liver, sperm and testis.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane. Cell projection > cilium > flagellum. In sperm flagellum this protein is located in the fibrous sheath, a non-mitochondrial region.
  • Information by UniProt

Images

  • ab164391 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up