Description

  • Product name

    Recombinant Human AP180 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATN ETNVNIPQMADTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASR NTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDFARVKK GADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLL FKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEF LKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNNEGSGAPS PLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLL DLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQI SDPFAPEPTPPTTTAEIATASASASTTTTVTAVTAEVDLFGDAFAASPGE APAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAAPELDLFAMKP PETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAATAAATTTTTTS AATATTAPPALDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQG ASPVPESSLTADLLSVDAFAAPSPATTASPAKVDSSGVIDLFGDAFGSSA SEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAA FGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAAS KALGSDLDSSLASLVGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVA PATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGFGMPPAGTGMP MMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLAD LNIKDFL
    • Predicted molecular weight

      119 kDa including tags
    • Amino acids

      1 to 907

Specifications

Our Abpromise guarantee covers the use of ab132068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 91 kDa synaptosomal associated protein
    • AP 180
    • AP3
    • Assembly Protein 180 kDa
    • Assembly Protein AP180
    • CALM
    • Clathrin coat assembly protein
    • Clathrin coat assembly protein AP180
    • Clathrin coat associated protein AP180
    • DKFZp781O051
    • F120
    • KIAA0656
    • NP185
    • pp155
    • SNAP 91
    • SNAP91
    • Synaptosomal associated protein 91 kD homolog
    • Synaptosomal associated protein 91 kDa homolog
    see all
  • Relevance

    AP180 is a clathrin binding phospho-protein and faciliates the formation of clathrin coats. This protein is also known as pp155, NP185, F1-20, and AP-3. During neurotransmitter release synaptic vesicles fuse with the presynaptic plasma membrane. A whole protein machinery consisting of amphiphysin, clathrin, endophilin and synaptojanin is involved in the subsequent endocytotic recycling of the synaptic vesicles.
  • Cellular localization

    Component of the coat surrounding the cytoplasmic face of coated vesicles in the plasma membrane.

Images

  • 12.5% SDS-PAGE analysis of ab132068, stained with Coomassie Blue.

References

ab132068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up