Overview

  • Product name
    Recombinant Human AP1G2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPA RGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ
    • Amino acids
      686 to 785
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AP-1 complex subunit gamma-like 2
    • Ap1g2
    • AP1G2_HUMAN
    • G2ad
    • Gamma2-adaptin
    see all
  • Function
    May function in protein sorting in late endosomes or multivesucular bodies (MVBs). Involved in MVB-asssisted maturation of hepatitis B virus (HBV).
  • Tissue specificity
    Expressed in all but one (skeletal muscle) tissues examined.
  • Sequence similarities
    Belongs to the adaptor complexes large subunit family.
    Contains 1 GAE domain.
  • Cellular localization
    Golgi apparatus membrane. Cytoplasmic vesicle membrane. Endosome membrane. Mainly localized to perinuclear vesicular structures. Colocalizes with HBV major surface antigen L and HBV core protein C in CD63-containing compartments. Colocalizes with HBV major surface antigen L to cis-Golgi-like structures.
  • Information by UniProt

Images

  • ab160256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up