Recombinant Human AP1S2 protein (ab108122)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human AP1S2 protein -
Purity
> 85 % SDS-PAGE.
ab108122 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMQFMLLFSRQGKLRLQKWYVPLSDKEKKKI TRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITL EIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV LKAIEQADLLQEEAETPRSVLEEIGLT -
Predicted molecular weight
21 kDa including tags -
Amino acids
1 to 157 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab108122 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0308% DTT, 0.316% Tris HCl, 40% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- Adapter related protein complex 1 sigma 1B subunit
- Adapter-related protein complex 1 sigma-1B subunit
- Adaptor protein complex AP 1 sigma 1B subunit
see all -
Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. -
Tissue specificity
Widely expressed. -
Involvement in disease
Defects in AP1S2 are the cause of mental retardation X-linked type 59 (MRX59) [MIM:300630]. It is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific X-linked mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation. MRX59 consists of a mild-to-profound mental retardation. Other features includes hypotonia early in life and delay in walking. -
Sequence similarities
Belongs to the adaptor complexes small subunit family. -
Cellular localization
Golgi apparatus. Cytoplasmic vesicle membrane. Membrane > clathrin-coated pit. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab108122 has not yet been referenced specifically in any publications.