Description

  • Product name

    Recombinant Human AP3M1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVIS TPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEA AIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGS SNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFA EIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSF IPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQN MGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQK LPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYK PFKGVKYVTKAGKFQVRT
    • Amino acids

      1 to 418
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adapter-related protein complex 3 mu-1 subunit
    • AP-3 adapter complex mu3A subunit
    • AP-3 complex subunit mu-1
    • AP3M1
    • AP3M1_HUMAN
    • Clathrin adaptor complex AP3 mu 3A subunit
    • Mu-adaptin 3A
    • mu3A
    • Mu3A-adaptin
    see all
  • Function

    Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
  • Sequence similarities

    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Cellular localization

    Golgi apparatus.
  • Information by UniProt

Images

  • ab162048 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up