Description

  • Product name

    Recombinant Human AP3M2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIP TPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEP VIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGS TNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITA EIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSF IPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQT MGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQK LPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYK PFKGIKYMTKAGKFQVRT
    • Amino acids

      1 to 418
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adapter related protein complex 3 mu 2 subunit
    • AP-3 complex subunit mu 2
    • Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
    • Clathrin coat assembly protein AP47 homolog 2
    • Clathrin coat associated protein AP47 homolog 2
    • Golgi adaptor AP1 47 kDa protein homolog 2
    • HA1 47 kDa subunit homolog 2
    • Mu3B adaptin
    • P47B
    see all
  • Relevance

    Part of the AP-3 complex, AP3M3 is an adaptor-related complex not clathrin-associated. The complex is associated with the Golgi region and to more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
  • Cellular localization

    Golgi apparatus.

Images

  • ab161211 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up