Overview

  • Product name

    Recombinant Human AP4M1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMH HHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEG TISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLS SVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIA SNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRV DEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFP SVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSP EQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPL GLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYV IRI
    • Molecular weight

      76 kDa including tags
    • Amino acids

      1 to 453

Specifications

Our Abpromise guarantee covers the use of ab132604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adapter-related protein complex 4 mu-1 subunit
    • Adaptor related protein complex 4 mu 1 subunit
    • Adaptor related protein complex AP 4 mu4 subunit
    • Adaptor related protein complex AP4 mu4 subunit
    • Adaptor-related protein complex AP-4, mu 1
    • AP 4 adapter complex mu subunit
    • AP 4 complex subunit mu 1
    • AP-4 adapter complex mu subunit
    • AP-4 complex subunit mu-1
    • AP4 adapter complex mu subunit
    • AP4 complex subunit mu 1
    • AP4M1
    • AP4M1_HUMAN
    • Ap4m4
    • CPSQ3
    • MU 4
    • Mu adaptin related protein 2
    • MU ARP2
    • Mu subunit of AP 4
    • Mu subunit of AP-4
    • Mu-adaptin-related protein 2
    • mu-ARP2
    • mu4
    • Mu4-adaptin
    • MUARP 2
    • MUARP2
    • SPG50
    see all
  • Function

    Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.
  • Tissue specificity

    Ubiquitous. Highly expressed in testis and lowly expressed in brain and lung.
  • Involvement in disease

    Defects in AP4M1 are the cause of cerebral palsy spastic quadriplegic type 3 (CPSQ3) [MIM:612936]. A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals present postnatally with early infantile hypotonia, delayed psychomotor development, strabismus, lack of independent walking and severe mental retardation. They develop progressive spasticity of all limbs with generalized hypertonia, hyperreflexia, and extensor plantar responses by the end of the first year of life. Speech is absent or limited. Pseudobulbar signs, such as drooling, stereotypic laughter, and exaggerated jaw jerk, are part of the clinical picture.
  • Sequence similarities

    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Domain

    Interacts specifically with tyrosine-based sorting signals.
  • Cellular localization

    Golgi apparatus > trans-Golgi network. Membrane > coated pit. Associated with the trans-Golgi network. Found in soma and dendritic shafts of neuronal cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132604 stained with Coomassie Blue.

References

ab132604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up