Description

  • Product name

    Recombinant Human APAF1 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHDYKDDDDKDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLT ISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGYKDLAAL LHDGIPVVSSSSVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEP GWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLM KLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWD SWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSL FVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQN KQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPT KVLCILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTE KNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMH KELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEF LSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEW INKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETG EKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDE HSETQVNCCHFTNSSHHLLLATGSSDCFLKLWDLNQKECRNTMFGHTNSV NHCRFSPDDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQED MEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHHSTIQYC DFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSS FLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRL QLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIF QSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQET VKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHD ATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDSTLLATGD DNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAG GYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQT LE
    • Predicted molecular weight

      143 kDa including tags
    • Amino acids

      2 to 1237
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      This product is for the mature full length Isoform 2 protein from aa 2 to 1237. The initial Met is not included. GenBank Accession No. NM_013229.

Specifications

Our Abpromise guarantee covers the use of ab198064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

    80 µg/ml DDDDK peptide

General Info

  • Alternative names

    • APAF 1
    • Apaf-1
    • APAF_HUMAN
    • Apaf1
    • Apoptotic peptidase activating factor 1
    • Apoptotic protease activating factor
    • Apoptotic protease activating factor 1
    • Apoptotic protease-activating factor 1
    • CED 4
    • CED4
    • KIAA0413
    see all
  • Function

    Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP. Isoform 6 is less effective in inducing apoptosis.
  • Tissue specificity

    Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
  • Sequence similarities

    Contains 1 CARD domain.
    Contains 1 NB-ARC domain.
    Contains 13 WD repeats.
  • Domain

    The CARD domain mediates interaction with APIP.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2.6 µg ab198064 with Coomassie staining.

References

ab198064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up