Overview

  • Product name

    Recombinant Human Apc10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL ETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGN NFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRD THMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 185

Specifications

Our Abpromise guarantee covers the use of ab131971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ANAPC 10
    • anapc10
    • Anaphase promoting complex 10
    • Anaphase promoting complex subunit 10
    • Anaphase-promoting complex subunit 10
    • Apc 10
    • APC10
    • APC10_HUMAN
    • Cyclosome subunit 10
    • DKFZP564L0562
    • Doc 1
    • Doc1
    • Doc1, S. cerevisiae, homolog of
    • OTTHUMP00000220297
    • OTTHUMP00000220298
    • OTTHUMP00000220299
    • OTTHUMP00000220300
    • OTTHUMP00000220303
    see all
  • Function

    Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the APC10 family.
    Contains 1 DOC domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab131971 at approximately 47.7 kDa.

References

ab131971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up