Overview

  • Product name
    Recombinant Human Apc5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEG AVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLM AEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQ VFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEE VSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDF AEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVL GQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMD ALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNS LEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPN SQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVV LQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEP ILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNY FAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVP LINHL
    • Amino acids
      1 to 755
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2510006G12Rik
    • AA408751
    • AA536819
    • AA986414
    • ANAPC 5
    • ANAPC5
    • Anaphase promoting complex subunit 5
    • Anaphase-promoting complex subunit 5
    • Apc 5
    • APC5
    • APC5_HUMAN
    • Cyclosome subunit 5
    • PDL 108
    • PDL108
    • Periodontal ligament fibroblast protein
    • RMC1
    see all
  • Function
    Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the APC5 family.
    Contains 4 TPR repeats.
  • Information by UniProt

Images

  • ab162549 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up