Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLT GLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGA DSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDT AVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYP AKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVK KATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGT IEVPKCFKEHSSLAFWKTDASDVKPCVDHHHHHH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      20 to 345
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Apolipoprotein H. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Activated protein C binding protein
    • Activated protein C-binding protein
    • Anticardiolipin cofactor
    • APC inhibitor
    • Apo-H
    • APOH
    • APOH_HUMAN
    • Apolipoprotein H
    • apolipoprotein H (beta-2-glycoprotein I)
    • B2G1
    • B2GP1
    • B2GPI
    • Beta 2 glycoprotein I
    • Beta 2 glycoprotein I precursor
    • Beta(2)GPI
    • Beta-2-glycoprotein 1
    • Beta-2-glycoprotein I
    • BG
    • Glycoprotein 1, beta-2
    • Glycoprotein I, beta-2
    • OTTMUSP00000003033
    see all
  • Function

    Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Contains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications

    N- and O-glycosylated. PubMed:6587378 also reports glycosylation on 'Asn-188' for their allele.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up