Overview

  • Product name
    Recombinant Human APOA1BP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTA LVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSI LSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTG RYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ
    • Amino acids
      1 to 185
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI BP
    • AIBP
    • ApoA I binding protein
    • Apolipoprotein A I binding protein
    • MGC119143
    • MGC119144
    • MGC119145
    • NAD(P)H hydrate epimerase
    • NAD(P)HX epimerase
    • YjeF N terminal domain containing protein 1
    • yjeF_N1
    • YJEFN1
    see all
  • Relevance
    APOA1BP interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I.
  • Cellular localization
    Mitochondrion. Secreted. Note: In sperm, secretion gradually increases during capacitation

Images

  • ab165294 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up