Overview

  • Product name

    Recombinant Human APOBEC3C/PBI protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSW KTGVFRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDC AGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDY EDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ
    • Amino acids

      1 to 190
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as APOBEC3C

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A3C
    • ABC3C_HUMAN
    • APOBEC1 like
    • APOBEC1-like
    • APOBEC1L
    • APOBEC3C
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3C
    • ARDC2
    • ARDC4
    • ARP5
    • bK150C2.3
    • DNA dC >dU editing enzyme APOBEC 3C
    • MGC19485
    • PBI
    • Phorbolin I
    • Phorbolin I protein
    • Probable DNA dC dU editing enzyme APOBEC 3C
    • Probable DNA dC->dU-editing enzyme APOBEC-3C
    see all
  • Function

    Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
  • Tissue specificity

    Expressed in spleen, testes, peripherical blood lymphocytes, heart, thymus, prostate and ovary.
  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Images

  • ab162154 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up