Recombinant Human APOBEC3F protein (ab165861)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQ EGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEIL
    • Amino acids
      274 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3F
    • ARP8
    • DNA dC->dU-editing enzyme APOBEC-3F
    • Induced upon T cell activation
    • KA6
    see all
  • Relevance
    APOBEC3F is a human protein with natural antiviral activity, especially against HIV. As such, it is currently the subject of intense scientific investigation, and may lead to the development of new therapeutics useful for treating HIV/AIDS. After being packaged into HIV-1 virions, APOBEC3F blocks productive infection by massively editing dC residues to dU on the DNA minus strand during reverse transcription. The editing of the minus strand DNA of HIV-1 during reverse transcription leads to G- to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations.
  • Cellular localization
    Cytoplasmic

Images

  • ab165861 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up