Description

  • Product name

    Recombinant Human APOBEC4 protein
    See all APOBEC4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFEPIYEEYLANHGTIVKPYYWL SFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELK TSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYS NNSPCNEANHCCISKMYNFLITYPGITLSIYFSQLYHTEMDFPASAWNRE ALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALAD RHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFF QMPSGQLQPNLPPDLRAPVVFVLVPLRDLPPMHMGQNPNKPRNIVRHLNM PQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGKK
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 367
    • Additional sequence information

      Expressed with a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal

Specifications

Our Abpromise guarantee covers the use of ab216240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose and DTT.

General Info

  • Alternative names

    • ABEC4_HUMAN
    • APOBEC 4
    • Apobec4
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4
    • Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 4
    • C1orf169
    • MGC26594
    • Putative C->U editing enzyme APOBEC4
    • Putative C->U-editing enzyme APOBEC-4
    see all
  • Function

    Putative C to U editing enzyme whose physiological substrate is not yet known.
  • Tissue specificity

    Predominantly expressed in testis.
  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

References

ab216240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up