Description

  • Product name

    Recombinant Human APOL2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEAD ELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLR ALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPFTEGISFVLLD TGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVG GNTPNVLTLVDNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRIS AEGGEQVERVVEGPAQAMSRGTMIVGAATGGILLLLDVVSLAYESKHLLE GAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ
    • Amino acids

      1 to 337
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 9830006J20Rik
    • ApoL-II
    • APOL2
    • APOL2_HUMAN
    • APOL3
    • Apol8
    • ApoLII
    • Apolipoprotein L 2
    • Apolipoprotein L, 2
    • Apolipoprotein L-II
    • Apolipoprotein L2
    • Apolipoprotein LII
    • ApolipoproteinL2
    see all
  • Function

    May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
  • Tissue specificity

    Widely expressed; the highest levels are found in lung, thymus, pancreas, placenta, adult brain and prostate; also detected in spleen, liver, kidney, colon, small intestine, uterus, spinal cord, adrenal gland, salivary gland, trachea, mammary gland, skeletal muscle, testis and fetal brain and liver.
  • Sequence similarities

    Belongs to the apolipoprotein L family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab161764 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up