Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME KVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APO A2
    • Apo AII
    • Apo-AII
    • APOA 2
    • ApoA II
    • ApoA-II
    • APOA2
    • APOA2_HUMAN
    • APOAII
    • Apolipoprotein A II
    • Apolipoprotein A-II(1-76)
    • Apolipoprotein A2
    • Apolipoprotein AII
    • ApolipoproteinA II
    • OTTHUMP00000032244
    see all
  • Function
    May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
  • Tissue specificity
    Plasma; synthesized in the liver and intestine.
  • Sequence similarities
    Belongs to the apolipoprotein A2 family.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab157897 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up