Description

  • Product name

    Recombinant Human Apolipoprotein B
    See all Apolipoprotein B proteins and peptides
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSF YAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLT STSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQN ALLRSEYQADY
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1406 to 1606
    • Additional sequence information

      E. coli derived ApoB100 fusion protein with His tag

Specifications

Our Abpromise guarantee covers the use of ab80037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    Redissolve the powder with 1 ml sterile water will restore to the original concentration 1 mg/ml.

General Info

  • Alternative names

    • Apo B
    • Apo B 100
    • Apo B-100
    • Apo B-48
    • Apo B100
    • Apo B48
    • APOB
    • ApoB 100
    • ApoB 48
    • APOB_HUMAN
    • Apolipoprotein B
    • Apolipoprotein B (including Ag(x) antigen)
    • Apolipoprotein B 100
    • Apolipoprotein B 48
    • Apolipoprotein B-48
    • Apolipoprotein B100
    • Apolipoprotein B48
    • FLDB
    • LDLCQ4
    see all
  • Function

    Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
  • Involvement in disease

    Hypobetalipoproteinemia, familial, 1
    Familial ligand-defective apolipoprotein B-100
    Defects in APOB associated with defects in other genes (polygenic) can contribute to hypocholesterolemia.
  • Sequence similarities

    Contains 1 vitellogenin domain.
  • Post-translational
    modifications

    Palmitoylated; structural requirement for proper assembly of the hydrophobic core of the lipoprotein particle.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • 20% SDS-PAGE gel analysis showing ab80037 at approximately 31 kDa. Commassie blue staining.

References

ab80037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

The protein was lyophilized from 1x PBS and there is no BSA or other protein in the buffer. If the solution is cloudy we don't expect there to be an issue with the quality, however if there is precipitate we suggest adding more water and agitating the solution to help it solubilize. Do not add other materials to the solution to aid reconstitution.

Read More

Answer

We have heard back from the lab regarding your inquiry about an ApoB antibody specific to the region from which the peptide ab80037 has been created. Unfortunately, the lab has not produced an antibody agaist this antigen. In review of our catalog, while we do offer a number of ApoB antibodies these have been created either from the full length protein or by peptides from different regions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up