Description

  • Product name

    Recombinant Human Apolipoprotein CII/ApoC-II
    See all Apolipoprotein CII/ApoC-II proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKL RDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      23 to 101
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 101. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Apolipoprotein CII

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 70% PBS, 30% Glycerol

General Info

  • Alternative names

    • APC 2
    • APC2
    • Apo CII
    • Apo-CII
    • APOC 2
    • ApoC II
    • ApoC-II
    • APOC2
    • APOC2 protein
    • APOC2_HUMAN
    • ApoCII
    • Apolipoprotein C II
    • Apolipoprotein C II precursor
    • Apolipoprotein C2
    • ApolipoproteinCII
    • MGC75082
    • ProapoC-II
    • Proapolipoprotein C-II
    see all
  • Function

    Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.
  • Tissue specificity

    Liver and intestine.
  • Involvement in disease

    Hyperlipoproteinemia 1B
  • Sequence similarities

    Belongs to the apolipoprotein C2 family.
  • Post-translational
    modifications

    Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing.
    Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate apolipoprotein C-II, which occurs as the minor form in plasma.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab191950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up